PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013625336.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 332aa    MW: 36478 Da    PI: 7.9659
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013625336.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.93.6e-161459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     + +W++eEd  l ++v+++G ++W++ ar ++ gRt+k+c++rw + 
   XP_013625336.1 14 KVAWSAEEDVVLSNLVEKFGARNWSLLARSVP-GRTGKSCRLRWCNQ 59
                     568*****************************.***********985 PP

2Myb_DNA-binding49.11.3e-1566108145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      r+++T+ Ed+ ++ a+  +G++ W+ Ia+ ++ gRt++ +k++w+
   XP_013625336.1  66 RNPFTEVEDQAIITAHGIHGNK-WSVIAKLLP-GRTDNAIKNHWN 108
                      789*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.438960IPR017930Myb domain
SuperFamilySSF466895.99E-3012107IPR009057Homeodomain-like
SMARTSM007175.7E-131362IPR001005SANT/Myb domain
PfamPF002498.7E-151459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-241667IPR009057Homeodomain-like
CDDcd001671.71E-131658No hitNo description
PROSITE profilePS5129424.44461115IPR017930Myb domain
SMARTSM007172.5E-1565113IPR001005SANT/Myb domain
PfamPF002491.2E-1366108IPR001005SANT/Myb domain
CDDcd001678.35E-1268111No hitNo description
Gene3DG3DSA:1.10.10.601.2E-2268114IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAGRSERRGK ERVKVAWSAE EDVVLSNLVE KFGARNWSLL ARSVPGRTGK SCRLRWCNQL  60
DPSLKRNPFT EVEDQAIITA HGIHGNKWSV IAKLLPGRTD NAIKNHWNAT LRRRCMDVEM  120
LTTNNLVPED SGFDRTMNTI AASSEETFSS GGGGHVTTPL VSSDGKEATS MDISEEQCRG  180
NDPPTLFRPV ARLSSFNAYN HMEGSSFSKF QSCKQDAAML RLLEGACNER FVPQKCGSGC  240
CSDSPVDISK QNSLLGPEFV DHLDPPTFPS YELAAIATEI SSLAWLRSGL ESSSVRAMEE  300
ATGRLRPQGS RGHRDHYLAS KQGKSITNVL ST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-35131146107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893940.0AC189394.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB055G10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013625336.10.0PREDICTED: transcription factor MYB44-like
TrEMBLA0A0D3BAF30.0A0A0D3BAF3_BRAOL; Uncharacterized protein
STRINGBra001323.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM84922636
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09230.11e-164myb domain protein 1